Search for tag: "domain"

How to Edit Wikipedia - unabridged version

How to Edit Wikipedia - unabridged version 2018 tutorial including how to navigate your way round a page.

psychological attitudevotrediesebracketsetceterainternet forum terminologypreviewhinzufügenpuedenwritingdiskussionsseiteneffectsdropdownstegocerareviewsourcetenemosspanish-language newspapersfuentedocumentscommunityhighlightingplantillanuevoblog softwarewikipedianpmidearliervandalismopen methodologiesguardianeditinghuman spaceflightwikimedialetterstegosaurusgui widgetsartikelcategoryrevertzusammenfassung"wiederverwendung"specscategoríaresearchincludereferencesclickunderstandcomputer networks"veröffentlichen"fieldssandboxcommonsautomaticutilisateursocial information processingreliableaccountwikipedia-nutzerstegocerasdrop-downkeywordtimestamppersonsinclusionleft-handphilosophical terminologyautomatiquementmodificationsur wikipédiacomputer graphicscetteles articleswikiprojectcolorusuariousernamecluebottitledinosaurserstellenpatrollinghochqualitativenappearinginformativoemailjenkinssubmitveröffentlichtmarketinghighestaccountabilitysocial groupsoptionimagelicencespaceinfobox10editsinformationscheckingpreferencesguidancefilms featuring a best actress goya award winning performancesquirreladdresseswerdehippie movementfacebooknumberreferencewebsitegeneratemass mediasociology of cultureeditorsbullettemplatelicenseuniversitairemillionseitekönnenmusical quartetsvous devriezpeer-reviewedartículoenlaceinsertcommentspublishgadgetcitationlibrary sciencesubjectright-handcaptchacommonautomáticamenteinterestdrop-down-funktionchangehistorycommunicationpouvezeditsnichtmicrosoft officeheadingwikimedia projectscreateacademic publishingeinenteaching with wikipediavirtual communitiesstatementformulaprojectgetting started with wikipedialinkspicturecommentscreenhomeopen educationaddressnotifiedsystemhypertextdiscussionreturndropdown-menütext editorsqualityuniversity-leveldiskussionsseiteinformation sciencedesplegablewikipediaenglish journalistsdirecltyklickenpasswordpáginarequirehabenschwesterprojektimagesahoramovingfrench lawpiledhigheranddeeperhighlightprojectsdata typesexistsedinburghwikiprojectshow to edit wikipediaspacecraft launched by delta ii rocketscontenidoprintingmicroeconomicsdirectdemographytítulosecond-highestsummarywikipédiatitreopen knowledgepiodhigheranddeepertechnical communication toolscontentwikepediacommememberssearchingextraarticlewerdenpersoncatégorieinternet terminologyjournalismsentenceuniversityaccessswitchréférencepeopleles deuxinternetheadingspencileconomics terminologymedia formatsopen content projectscaptureeditorcursorperiodicalscategoriesdéroulantmaintenantcheckacademicpaper productsfilm and video technologytambiénisbnopen contenthand-sidecomputer lawreferenciadoimomentfree content management systemsobesityurlchoosetextual criticismconcepts in physicspersonal lifeinformación
From  Ewan McAndrew 8 Months ago 0 likes 3 views 0  

Artificial Intelligence Planning - Domains and problems 1

This project was created by the School of Informatics, University of Edinburgh.

From  Lucy Kendra A year ago 0 likes 12 views

Dr David Kaufman, 'Empire or Continent?: British Foreign Policy in the Era of the Great War'

Dr David Kaufman introduces his online course 'Empire or Continent?: British Foreign Policy in the Era of the Great War', part of the online MSc History programme at the University of…

From  Kacper Lyszkiewicz A year ago 0 likes 32 views 0