Search for tag: "ontology"

Employ.ed for PhDs Case Study - Emma Waterson

Employ.ed for PhDs Case Study - Emma Waterson, PhD Intern

From  Jane Challinor 5 Months ago 0 likes 13 views 0  

Dr Torgny Roxå

Strong and weak ties – changing teaching cultures in higher education in programme Torgny Roxå Lund University, Sweden Learning & Teaching Conference 2018

computer sciencetrainingeffectsinterestingidentityeducation theoryschool terminologyhuman geographypolitical philosophycontrol theorypedagogycountries in europephilosophical terminologybehaviorconferencesnovels first published in serial formmanufacturingdecision theoryteachersociology of cultureforms of governmentsystems theoryuniversitycommunicationconstructionnetworksculturesemanticscultural anthropologypropertypsychologytheoretical computer scienceeducational psychologyliteraturelabour lawg20 nationscitiesacademicacademiamicroculturecognitive sciencecultural conventionsartificial intelligencetypes of organizationhippie movementeducational stagesorganizationinformation sciencestrong tiesstudentsresearch methodsnorthern europeteachingpublic relationscognitive psychologylinguisticsintelligencemanagementstudentinvestmenthuman rightsindividualpragmaticsacademic administrationindividualismhigher educationsocial groupssocial networking servicestruthpolitical science termsinstitutesconversationthingclubs and societiesdisciplinelearningbiologygovernmentinterpersonal relationshipsschool typesliberal democraciessocietylogicpeoplemotivationplaceorgansgermanic countries and territorieseducationwritingcreativitybusinesslanguagehumanitiesconstitutional monarchiescyberneticsanimal anatomypersonhoodinternet terminologysystems sciencedepartmentfamilyresponsibilitycommunityfictionconferenceconcepts in physicsanthropologistspeer recognitionpersonal developmentswedish wordsociology indexcolleaguetypes of university or collegeemotionapplied linguisticseconomic anthropologyhuman behaviorweak tiespublic commonslearning and teaching conference 2018education terminologypolitical terminology
From  Paolo Drusi 6 Months ago 0 likes 61 views 0  

Six in six minutes - 3 students and 3 staff discuss Wikipedia in the Classroom at the University of Edinburgh

Contributors include:Karoline Nanfeldt - 4th year Psychology undergraduate student. Tomas Sanders - 4th year History undergraduate student. Aine Kavanagh - Senior Hons. Reproductive Biology student.…

From  Ewan McAndrew 7 Months ago 0 likes 30 views 0  

Immunotherapy in Haematology

An overview of some exciting treatments for haematological disorders - insights gained from allogeneic stem cell transplant - antibody based therapies and their variants - cellular therapies

From  Neill Storrar 7 Months ago 0 likes 3 views 0  

Immunopathology in Haematology

A video illustrating the way that immunological techniques are used in haematopathology: - immunohistochemistry - Fluorescent In Situ Hybridisation - Flow cytometry with immunophenotyping

From  Neill Storrar 7 Months ago 0 likes 5 views 0  

How to Edit Wikipedia - unabridged version

How to Edit Wikipedia - unabridged version 2018 tutorial including how to navigate your way round a page.

psychological attitudevotrediesebracketsetceterainternet forum terminologypreviewhinzufügenpuedenwritingdiskussionsseiteneffectsdropdownstegocerareviewsourcetenemosspanish-language newspapersfuentedocumentscommunityhighlightingplantillanuevoblog softwarewikipedianpmidearliervandalismopen methodologiesguardianeditinghuman spaceflightwikimedialetterstegosaurusgui widgetsartikelcategoryrevertzusammenfassung"wiederverwendung"specscategoríaresearchincludereferencesclickunderstandcomputer networks"veröffentlichen"fieldssandboxcommonsautomaticutilisateursocial information processingreliableaccountwikipedia-nutzerstegocerasdrop-downkeywordtimestamppersonsinclusionleft-handphilosophical terminologyautomatiquementmodificationsur wikipédiacomputer graphicscetteles articleswikiprojectcolorusuariousernamecluebottitledinosaurserstellenpatrollinghochqualitativenappearinginformativoemailjenkinssubmitveröffentlichtmarketinghighestaccountabilitysocial groupsoptionimagelicencespaceinfobox10editsinformationscheckingpreferencesguidancefilms featuring a best actress goya award winning performancesquirreladdresseswerdehippie movementfacebooknumberreferencewebsitegeneratemass mediasociology of cultureeditorsbullettemplatelicenseuniversitairemillionseitekönnenmusical quartetsvous devriezpeer-reviewedartículoenlaceinsertcommentspublishgadgetcitationlibrary sciencesubjectright-handcaptchacommonautomáticamenteinterestdrop-down-funktionchangehistorycommunicationpouvezeditsnichtmicrosoft officeheadingwikimedia projectscreateacademic publishingeinenteaching with wikipediavirtual communitiesstatementformulaprojectgetting started with wikipedialinkspicturecommentscreenhomeopen educationaddressnotifiedsystemhypertextdiscussionreturndropdown-menütext editorsqualityuniversity-leveldiskussionsseiteinformation sciencedesplegablewikipediaenglish journalistsdirecltyklickenpasswordpáginarequirehabenschwesterprojektimagesahoramovingfrench lawpiledhigheranddeeperhighlightprojectsdata typesexistsedinburghwikiprojectshow to edit wikipediaspacecraft launched by delta ii rocketscontenidoprintingmicroeconomicsdirectdemographytítulosecond-highestsummarywikipédiatitreopen knowledgepiodhigheranddeepertechnical communication toolscontentwikepediacommememberssearchingextraarticlewerdenpersoncatégorieinternet terminologyjournalismsentenceuniversityaccessswitchréférencepeopleles deuxinternetheadingspencileconomics terminologymedia formatsopen content projectscaptureeditorcursorperiodicalscategoriesdéroulantmaintenantcheckacademicpaper productsfilm and video technologytambiénisbnopen contenthand-sidecomputer lawreferenciadoimomentfree content management systemsobesityurlchoosetextual criticismconcepts in physicspersonal lifeinformación
From  Ewan McAndrew 8 Months ago 0 likes 3 views 0