Search for tag: "preventing dementia"

Dementia Prevention Open Lecture Series - What is Neurodegenerative Disease? Part 1

What is Neurodegenerative Disease? Part 1In our first lecture, Prof. Craig Ritchie will provide an introduction to the Dementia Prevention Open Lecture Series, discusses how, when and where dementia…

From  Robbie Bushe 3 Days ago 0 likes 30 views 0  

Dr Torgny Roxå

Strong and weak ties – changing teaching cultures in higher education in programme Torgny Roxå Lund University, Sweden Learning & Teaching Conference 2018

computer sciencetrainingeffectsinterestingidentityeducation theoryschool terminologyhuman geographypolitical philosophycontrol theorypedagogycountries in europephilosophical terminologybehaviorconferencesnovels first published in serial formmanufacturingdecision theoryteachersociology of cultureforms of governmentsystems theoryuniversitycommunicationconstructionnetworksculturesemanticscultural anthropologypropertypsychologytheoretical computer scienceeducational psychologyliteraturelabour lawg20 nationscitiesacademicacademiamicroculturecognitive sciencecultural conventionsartificial intelligencetypes of organizationhippie movementeducational stagesorganizationinformation sciencestrong tiesstudentsresearch methodsnorthern europeteachingpublic relationscognitive psychologylinguisticsintelligencemanagementstudentinvestmenthuman rightsindividualpragmaticsacademic administrationindividualismhigher educationsocial groupssocial networking servicestruthpolitical science termsinstitutesconversationthingclubs and societiesdisciplinelearningbiologygovernmentinterpersonal relationshipsschool typesliberal democraciessocietylogicpeoplemotivationplaceorgansgermanic countries and territorieseducationwritingcreativitybusinesslanguagehumanitiesconstitutional monarchiescyberneticsanimal anatomypersonhoodinternet terminologysystems sciencedepartmentfamilyresponsibilitycommunityfictionconferenceconcepts in physicsanthropologistspeer recognitionpersonal developmentswedish wordsociology indexcolleaguetypes of university or collegeemotionapplied linguisticseconomic anthropologyhuman behaviorweak tiespublic commonslearning and teaching conference 2018education terminologypolitical terminology
From  Paolo Drusi 7 Months ago 0 likes 60 views 0  

Learning from Other Places: Improving Choice for People with Dementia

This film is part of a series which highlights the outcomes and learning from 6 programmes supported under the 2016 SUII call for proposals - Learning from other places. Programmes focused on…

From  Anne Mourad 7 Months ago 0 likes 6 views 0  

Dr Tom MacGillivray - Research in a nutshell

Hear from Dr Tom MacGillivray, a Senior Research Fellow as he highlights the main focus of his research - how retinal imaging might tell us more about human body & brain health, especially in…

From  Chloe Martin 7 Months ago 0 likes 58 views 0  

Dr Fergus Doubal - Research in a nutshell

Hear from Dr Fergus Doubal, a Senior Stroke Researcher at the University of Edinburgh, as he highlights his research using brain imaging & retinal imaging to investigate dementia & stroke.

From  Chloe Martin 8 Months ago 0 likes 30 views 0  

Dr Gerry Thompson - Research in a nutshell

Hear from Dr Gerry Thompson, consultant neuroradiologist and Senior Clinical Lecturer in Radiology, as he highlights his research focus on brain imaging like PET & MR, to better characterize…

From  Chloe Martin 8 Months ago 0 likes 38 views 0  

How to Edit Wikipedia - unabridged version

How to Edit Wikipedia - unabridged version 2018 tutorial including how to navigate your way round a page.

psychological attitudevotrediesebracketsetceterainternet forum terminologypreviewhinzufügenpuedenwritingdiskussionsseiteneffectsdropdownstegocerareviewsourcetenemosspanish-language newspapersfuentedocumentscommunityhighlightingplantillanuevoblog softwarewikipedianpmidearliervandalismopen methodologiesguardianeditinghuman spaceflightwikimedialetterstegosaurusgui widgetsartikelcategoryrevertzusammenfassung"wiederverwendung"specscategoríaresearchincludereferencesclickunderstandcomputer networks"veröffentlichen"fieldssandboxcommonsautomaticutilisateursocial information processingreliableaccountwikipedia-nutzerstegocerasdrop-downkeywordtimestamppersonsinclusionleft-handphilosophical terminologyautomatiquementmodificationsur wikipédiacomputer graphicscetteles articleswikiprojectcolorusuariousernamecluebottitledinosaurserstellenpatrollinghochqualitativenappearinginformativoemailjenkinssubmitveröffentlichtmarketinghighestaccountabilitysocial groupsoptionimagelicencespaceinfobox10editsinformationscheckingpreferencesguidancefilms featuring a best actress goya award winning performancesquirreladdresseswerdehippie movementfacebooknumberreferencewebsitegeneratemass mediasociology of cultureeditorsbullettemplatelicenseuniversitairemillionseitekönnenmusical quartetsvous devriezpeer-reviewedartículoenlaceinsertcommentspublishgadgetcitationlibrary sciencesubjectright-handcaptchacommonautomáticamenteinterestdrop-down-funktionchangehistorycommunicationpouvezeditsnichtmicrosoft officeheadingwikimedia projectscreateacademic publishingeinenteaching with wikipediavirtual communitiesstatementformulaprojectgetting started with wikipedialinkspicturecommentscreenhomeopen educationaddressnotifiedsystemhypertextdiscussionreturndropdown-menütext editorsqualityuniversity-leveldiskussionsseiteinformation sciencedesplegablewikipediaenglish journalistsdirecltyklickenpasswordpáginarequirehabenschwesterprojektimagesahoramovingfrench lawpiledhigheranddeeperhighlightprojectsdata typesexistsedinburghwikiprojectshow to edit wikipediaspacecraft launched by delta ii rocketscontenidoprintingmicroeconomicsdirectdemographytítulosecond-highestsummarywikipédiatitreopen knowledgepiodhigheranddeepertechnical communication toolscontentwikepediacommememberssearchingextraarticlewerdenpersoncatégorieinternet terminologyjournalismsentenceuniversityaccessswitchréférencepeopleles deuxinternetheadingspencileconomics terminologymedia formatsopen content projectscaptureeditorcursorperiodicalscategoriesdéroulantmaintenantcheckacademicpaper productsfilm and video technologytambiénisbnopen contenthand-sidecomputer lawreferenciadoimomentfree content management systemsobesityurlchoosetextual criticismconcepts in physicspersonal lifeinformación
From  Ewan McAndrew 9 Months ago 0 likes 4 views 0  

Alzheimer's dementia / disease profiling sequence

A quick series of graphics for the Centre for Clinical Brain Sciences. Part of a presentation by Prof Craig W. Ritchie. Wacom Speed paintings, Indesign layout, Afterffects composition / colour grade…

From  Stuart Brett 10 Months ago 0 likes 11 views 0