Search for tag: "sequence"

How to use a Sennheiser G3 Handheld Radio Microphone in Teaching Rooms

This video will show you how to us a Handheld Sennheiser G3 Radio Microphone in Teaching Rooms. If you have any questions or would like a familiarisation session please contact Learning Spaces…

From  Alan Hamilton 7 Months ago 0 likes 12 views 0  

How to Edit Wikipedia - unabridged version

How to Edit Wikipedia - unabridged version 2018 tutorial including how to navigate your way round a page.

psychological attitudevotrediesebracketsetceterainternet forum terminologypreviewhinzufügenpuedenwritingdiskussionsseiteneffectsdropdownstegocerareviewsourcetenemosspanish-language newspapersfuentedocumentscommunityhighlightingplantillanuevoblog softwarewikipedianpmidearliervandalismopen methodologiesguardianeditinghuman spaceflightwikimedialetterstegosaurusgui widgetsartikelcategoryrevertzusammenfassung"wiederverwendung"specscategoríaresearchincludereferencesclickunderstandcomputer networks"veröffentlichen"fieldssandboxcommonsautomaticutilisateursocial information processingreliableaccountwikipedia-nutzerstegocerasdrop-downkeywordtimestamppersonsinclusionleft-handphilosophical terminologyautomatiquementmodificationsur wikipédiacomputer graphicscetteles articleswikiprojectcolorusuariousernamecluebottitledinosaurserstellenpatrollinghochqualitativenappearinginformativoemailjenkinssubmitveröffentlichtmarketinghighestaccountabilitysocial groupsoptionimagelicencespaceinfobox10editsinformationscheckingpreferencesguidancefilms featuring a best actress goya award winning performancesquirreladdresseswerdehippie movementfacebooknumberreferencewebsitegeneratemass mediasociology of cultureeditorsbullettemplatelicenseuniversitairemillionseitekönnenmusical quartetsvous devriezpeer-reviewedartículoenlaceinsertcommentspublishgadgetcitationlibrary sciencesubjectright-handcaptchacommonautomáticamenteinterestdrop-down-funktionchangehistorycommunicationpouvezeditsnichtmicrosoft officeheadingwikimedia projectscreateacademic publishingeinenteaching with wikipediavirtual communitiesstatementformulaprojectgetting started with wikipedialinkspicturecommentscreenhomeopen educationaddressnotifiedsystemhypertextdiscussionreturndropdown-menütext editorsqualityuniversity-leveldiskussionsseiteinformation sciencedesplegablewikipediaenglish journalistsdirecltyklickenpasswordpáginarequirehabenschwesterprojektimagesahoramovingfrench lawpiledhigheranddeeperhighlightprojectsdata typesexistsedinburghwikiprojectshow to edit wikipediaspacecraft launched by delta ii rocketscontenidoprintingmicroeconomicsdirectdemographytítulosecond-highestsummarywikipédiatitreopen knowledgepiodhigheranddeepertechnical communication toolscontentwikepediacommememberssearchingextraarticlewerdenpersoncatégorieinternet terminologyjournalismsentenceuniversityaccessswitchréférencepeopleles deuxinternetheadingspencileconomics terminologymedia formatsopen content projectscaptureeditorcursorperiodicalscategoriesdéroulantmaintenantcheckacademicpaper productsfilm and video technologytambiénisbnopen contenthand-sidecomputer lawreferenciadoimomentfree content management systemsobesityurlchoosetextual criticismconcepts in physicspersonal lifeinformación
From  Ewan McAndrew 9 Months ago 0 likes 4 views 0  

Learning Technology Showcase March 2018, Part 2

Lecture Technology Showcase (run by the Learning Teaching and Web division of Information Services, University of Edinburgh) of 29th March 2018 on the subject of lecture recording. Part 2. Speakers:…

From  Brendan Hill 10 Months ago 0 likes 46 views 0  

How to use a clip on Sennheiser G3 Radio Microphone in Teaching Rooms

This video will show you how to us a clip on Sennheiser G3 Radio Microphone in Teaching Rooms. If you have any questions or would like a familiarisation session please contact Learning Spaces…

From  Alan Hamilton A year ago 0 likes 102 views 0  

Epilepsy: is the genetic revolution friend or foe?

Wednesday 15th March 2017In this lecture Dr Richard FM Chin and Professor Cathy Abbott explore how rapid advances in the field of genetics has changed our understanding of the cause(s) of epilepsy…

From  Jillian Hosie A year ago 0 likes 98 views 0  

DNA sequencing

DNA sequencing

From  Heather McQueen A year ago 0 likes 361 views 0  

Economic Democracy Block2 v2

Welcome to Economic Democracy: The Cooperative Alternative, our MOOC about worker-owned and worker-controlled firms. We often hear that political democracy is the best available form of…

From  Nuria Fraile Diaz 2 Years ago 0 likes 8 views 0